PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN540543.1_FGP003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 248aa    MW: 27322.9 Da    PI: 9.1737
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN540543.1_FGP003genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.82.9e-092873347
                       SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                       +W++eE +++ +a + l  +  +W+++a+ ++ gR++ ++ ++++++
  KN540543.1_FGP003 28 KWSPEENKQFERALAGLDLRcpDWDRVASAIP-GRSALEVMNHFRDL 73
                       8*****************99************.***********976 PP

2Myb_DNA-binding28.53.6e-091021391047
                        HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        el++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  KN540543.1_FGP003 102 ELFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 139
                        79999********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.1E-42576IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-42772IPR009057Homeodomain-like
SuperFamilySSF466893.44E-82881IPR009057Homeodomain-like
CDDcd001671.41E-72873No hitNo description
PfamPF002493.1E-82873IPR001005SANT/Myb domain
PROSITE profilePS500906.1682874IPR017877Myb-like domain
SMARTSM007170.003892142IPR001005SANT/Myb domain
CDDcd001671.05E-6102140No hitNo description
SuperFamilySSF466891.72E-10102144IPR009057Homeodomain-like
PfamPF002491.7E-6102139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-6102138IPR009057Homeodomain-like
PROSITE profilePS500904.762102140IPR017877Myb-like domain
TIGRFAMsTIGR015572.6E-10103142IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MMMRDVCMEV LPPMDHYASR GNWFMARKWS PEENKQFERA LAGLDLRCPD WDRVASAIPG  60
RSALEVMNHF RDLELDVQQI ENGMVPFPVY GAAAAVRAST LELFLLGLKK YGKGDWRNIS  120
RNFVQTRTPT QVASHAQKYF IRLNSGGKDK RRSSIHDITT VNLTDDRPPS PSQSSLISNQ  180
SNTSTLTAAV APFSSTADVK PQNAANASFS SPSRTLGMAG YGMGLQDQGL QCGGPLHDQL  240
AASRSILF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679640.0AK067964.1 Oryza sativa Japonica Group cDNA clone:J013124L02, full insert sequence.
GenBankEU8372500.0EU837250.1 Oryza sativa Japonica Group clone KCB707G04 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621817.11e-168PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H78e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0FQU51e-168A0A0E0FQU5_ORYNI; Uncharacterized protein
TrEMBLB8AD741e-168B8AD74_ORYSI; Putative uncharacterized protein
TrEMBLQ0JQS21e-168Q0JQS2_ORYSJ; MYB transcription factor
STRINGLOC_Os01g04930.11e-168(Oryza sativa Japonica Group)
STRINGBGIOSGA002421-PA1e-168(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-42MYB family protein